Identified secondary metabolite regions

NC_003888.3 (Streptomyces coelicolor A3(2))
Region Type From To Most similar known cluster Similarity
Region 1 hglE-KS,T1PKS 86,637 139,654 Leinamycin nrps-t1pks+transatpks 2%
Region 2 terpene 166,891 191,654 Isorenieratene terpene 100%
Region 3 lanthipeptide 246,868 270,397
Region 4 NRPS 494,260 544,087 Coelichelin NRPS 100%
Region 5 bacteriocin 791,701 799,942 Informatipeptin lanthipeptide 42%
Region 6 T3PKS 1,258,218 1,297,040 Herboxidiene t1pks+t3pks 8%
Region 7 ectoine 1,995,500 2,005,898 Ectoine other 100%
Region 8 melanin 2,939,306 2,949,875 Istamycin saccharide 4%
Region 9 siderophore 3,034,632 3,045,603 Desferrioxamine B other 83%
Region 10 NRPS 3,524,828 3,603,907 Calcium-dependent antibiotic NRPS 87%
Region 11 T2PKS 5,496,474 5,567,376 Actinorhodin t2pks 100%
Region 12 terpene 5,671,275 5,691,836 Albaflavenone terpene 100%
Region 13 T2PKS 5,751,945 5,824,487 Spore pigment t2pks 66%
Region 14 siderophore 6,336,091 6,346,368
Region 15 T1PKS,NRPS-like 6,430,010 6,475,291 Undecylprodigiosin nrps-t1pks+t2pks 100%
Region 16 bacteriocin 6,632,343 6,643,659
Region 17 terpene 6,656,904 6,676,224 Geosmin terpene 100%
Region 18 siderophore 6,842,315 6,855,522 Enduracidin NRPS 6%
Region 19 T1PKS,butyrolactone 6,881,335 6,951,537 Coelimycin t1pks 100%
Region 20 NRPS 7,088,518 7,135,153 Nogalamycin t2pks 40%
Region 21 lanthipeptide 7,409,712 7,428,411 SapB lanthipeptide 100%
Region 22 terpene 7,506,308 7,532,117 Hopene terpene 100%
Region 23 PKS-like,T1PKS 7,570,412 7,618,555 Arsenopolyketides other 100%
Region 24 lanthipeptide 7,682,907 7,709,360
Region 25 other 7,973,470 8,014,357
Region 26 indole 8,269,637 8,290,764 Terfestatin other 28%
Region 27 T3PKS,NRPS,terpene 8,475,102 8,548,352 Coelibactin NRPS 100%
NC_003888 - Region 1 - T1PKS,hglE-KS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 86,637 - 139,654 nt. (total: 53,018 nt) Show pHMM detection rules used
hglE-KS: (hglE or hglD)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 1, location 86636 - 139654:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(ccmal) + (mxmal)

Direct lookup in NORINE database: strict or relaxed
NRPS/PKS monomer predictions
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
SCO0126: ccmal
PKS_AT (611..907): ccmal
minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 81.1
Methoxymalonyl-CoA: 30.9
Methylmalonyl-CoA: 25.6
inactive: 23.2
Propionyl-CoA: 13.8
2-Methylbutyryl-CoA: 12.2
fatty_acid: 7.9
Isobutyryl-CoA: 1.8
CHC-CoA: 1.1
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -3.2

ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 79.2%
inactive: 70.8%
2-Rhyd-Malonyl-CoA: 58.3%


SCO0127: mxmal
PKS_AT (968..1194): mxmal
minowa: Methoxymalonyl-CoA
Prediction, score:
Methoxymalonyl-CoA: 29.2
Methylmalonyl-CoA: 26.5
Malonyl-CoA: 22.1
Ethylmalonyl-CoA: 13.7
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Propionyl-CoA: -0.2
2-Methylbutyryl-CoA: -4.3

ATSignature: (unknown)
No matches above 50%


NC_003888 - Region 2 - terpene
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 166,891 - 191,654 nt. (total: 24,764 nt) Show pHMM detection rules used
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 3 - lanthipeptide
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 246,868 - 270,397 nt. (total: 23,530 nt) Show pHMM detection rules used
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
Lanthipeptides
ClusterBlast
KnownClusterBlast
SubClusterBlast
Lanthipeptide predictions
Lists the possible core peptides for each biosynthetic enzyme, including the predicted class. Each core peptide shows the leader and core peptide sequences, separated by a dash.

Lanthipeptide(s) for SCO0269 - Putative Class I


SCO0268 leader / core peptide
MRTEIVLSHEAPELDLDLDLRVSDLPEQA - ADhaFGEGDhbFDhbDhaPDhaDhaYAIGDhbRCPICC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.

No matches found.

Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

Lanthipeptides
Core peptide predictions
Lists the possible core peptides in the region. Each core peptide lists the number of lanthionine bridges, possible molecular weights, and the scores for cleavage site prediction and RODEO.
SCO0268 - Class I
Cleavage pHMM score: -8.70
RODEO score: 18
Monoisotopic mass: 2328.1 Da
Molecular weight: 2329.6 Da
Number of bridges: 3
Alternative weights
(assuming N unmodified Ser/Thr residues)
2347.6 Da N = 1
2365.6 Da N = 2
2383.7 Da N = 3
2401.7 Da N = 4
NC_003888 - Region 4 - NRPS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 494,260 - 544,087 nt. (total: 49,828 nt) Show pHMM detection rules used
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 4, location 494259 - 544087:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(orn - thr - orn)

Direct lookup in NORINE database: strict or relaxed
NRPS/PKS monomer predictions
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
SCO0492: orn - thr - orn
Search NORINE for peptide: strict or relaxed

AMP-binding (142..540): orn
NRPSPredictor2: orn
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
orn, lys, arg
Small clusters prediction:
orn, horn
Single AA prediction:
orn
Stachelhaus prediction details:
Stachelhaus sequence:
DINYWGGIGK
Nearest Stachelhaus code:
orn
Stachelhaus code match:
100% (strong)

AMP-binding (1625..2039): thr
NRPSPredictor2: thr
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
ser, thr, dhpg, hpg
Small clusters prediction:
thr
Single AA prediction:
thr
Stachelhaus prediction details:
Stachelhaus sequence:
DFWNIGMVHK
Nearest Stachelhaus code:
thr
Stachelhaus code match:
100% (strong)

AMP-binding (3060..3462): orn
NRPSPredictor2: orn
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
orn, lys, arg
Small clusters prediction:
N/A
Single AA prediction:
N/A
Stachelhaus prediction details:
Stachelhaus sequence:
DMwNLGLINK
Nearest Stachelhaus code:
orn
Stachelhaus code match:
90% (moderate)


NC_003888 - Region 5 - bacteriocin
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 791,701 - 799,942 nt. (total: 8,242 nt) Show pHMM detection rules used
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 6 - T3PKS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 1,258,218 - 1,297,040 nt. (total: 38,823 nt) Show pHMM detection rules used
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 7 - ectoine
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 1,995,500 - 2,005,898 nt. (total: 10,399 nt) Show pHMM detection rules used
ectoine: ectoine_synt

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 8 - melanin
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 2,939,306 - 2,949,875 nt. (total: 10,570 nt) Show pHMM detection rules used
melanin: melC

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 9 - siderophore
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 3,034,632 - 3,045,603 nt. (total: 10,972 nt) Show pHMM detection rules used
siderophore: IucA_IucC

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 10 - NRPS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 3,524,828 - 3,603,907 nt. (total: 79,080 nt) Show pHMM detection rules used
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 10, location 3524827 - 3603907:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(ser - thr - trp - asp - asp - hpg) + (asp - gly - asn) + (3-me-glu - trp)

Direct lookup in NORINE database: strict or relaxed
NRPS/PKS monomer predictions
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
SCO3230: ser - thr - trp - asp - asp - hpg
Search NORINE for peptide: strict or relaxed

AMP-binding (475..883): ser
NRPSPredictor2: ser
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
ser, thr, dhpg, hpg
Small clusters prediction:
ser
Single AA prediction:
ser
Stachelhaus prediction details:
Stachelhaus sequence:
DVWHFSLVDK
Nearest Stachelhaus code:
ser
Stachelhaus code match:
100% (strong)

AMP-binding (1674..2097): thr
NRPSPredictor2: thr
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
ser, thr, dhpg, hpg
Small clusters prediction:
thr
Single AA prediction:
thr
Stachelhaus prediction details:
Stachelhaus sequence:
DFWNVGMVHK
Nearest Stachelhaus code:
thr
Stachelhaus code match:
100% (strong)

AMP-binding (2759..3160): trp
NRPSPredictor2: trp
SVM prediction details:
Predicted physicochemical class:
N/A
Large clusters prediction:
phe, trp, phg, tyr, bht
Small clusters prediction:
phe, trp
Single AA prediction:
trp
Stachelhaus prediction details:
Stachelhaus sequence:
DAWSVGSVCK
Nearest Stachelhaus code:
trp
Stachelhaus code match:
100% (strong)

AMP-binding (4283..4657): asp
NRPSPredictor2: asp
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
asp, asn, glu, gln, aad
Small clusters prediction:
asp, asn
Single AA prediction:
asp
Stachelhaus prediction details:
Stachelhaus sequence:
DLTKIGAVNK
Nearest Stachelhaus code:
asp
Stachelhaus code match:
100% (strong)

AMP-binding (5323..5697): asp
NRPSPredictor2: asp
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
asp, asn, glu, gln, aad
Small clusters prediction:
asp, asn
Single AA prediction:
asp
Stachelhaus prediction details:
Stachelhaus sequence:
DLTKIGAVNK
Nearest Stachelhaus code:
asp
Stachelhaus code match:
100% (strong)

AMP-binding (6360..6777): hpg
NRPSPredictor2: hpg
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
ser, thr, dhpg, hpg
Small clusters prediction:
dhpg, hpg
Single AA prediction:
hpg
Stachelhaus prediction details:
Stachelhaus sequence:
DVYHLGLLCK
Nearest Stachelhaus code:
hpg
Stachelhaus code match:
100% (strong)


SCO3231: asp - gly - asn
Search NORINE for peptide: strict or relaxed

AMP-binding (472..845): asp
NRPSPredictor2: asp
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
asp, asn, glu, gln, aad
Small clusters prediction:
asp, asn
Single AA prediction:
asp
Stachelhaus prediction details:
Stachelhaus sequence:
DLTKIGAVNK
Nearest Stachelhaus code:
asp
Stachelhaus code match:
100% (strong)

AMP-binding (1504..1884): gly
NRPSPredictor2: gly
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
gly, ala, val, leu, ile, abu, iva
Small clusters prediction:
gly, ala
Single AA prediction:
gly
Stachelhaus prediction details:
Stachelhaus sequence:
DILQLGLIWK
Nearest Stachelhaus code:
gly
Stachelhaus code match:
100% (strong)

AMP-binding (2567..2973): asn
NRPSPredictor2: asn
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
asp, asn, glu, gln, aad
Small clusters prediction:
asp, asn
Single AA prediction:
asn
Stachelhaus prediction details:
Stachelhaus sequence:
DLTKVGEVGK
Nearest Stachelhaus code:
asn
Stachelhaus code match:
100% (strong)


SCO3232: 3-me-glu - trp
Search NORINE for peptide: strict or relaxed

AMP-binding (467..874): 3-me-glu
NRPSPredictor2: 3-me-glu
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
gly, ala, val, leu, ile, abu, iva
Small clusters prediction:
asp, asn
Single AA prediction:
N/A
Stachelhaus prediction details:
Stachelhaus sequence:
DQGKTGVGHK
Nearest Stachelhaus code:
3-me-glu
Stachelhaus code match:
100% (strong)

AMP-binding (1541..1936): trp
NRPSPredictor2: trp
SVM prediction details:
Predicted physicochemical class:
N/A
Large clusters prediction:
phe, trp, phg, tyr, bht
Small clusters prediction:
phe, trp
Single AA prediction:
trp
Stachelhaus prediction details:
Stachelhaus sequence:
DGWAVASVCK
Nearest Stachelhaus code:
trp
Stachelhaus code match:
100% (strong)


NC_003888 - Region 11 - T2PKS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 5,496,474 - 5,567,376 nt. (total: 70,903 nt) Show pHMM detection rules used
T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Type II PKS
Type II PKS gene cluster prediction details
Predictions of starter units, elongations, product classes, and potential molecular weights for type II PKS clusters.
More detailed information is available here.
Cluster section:
5496473 to 5567376
Starter unit(s):
acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:
7 (Score: 743.5; E-value: 1.2e-226)
Product class(es):
benzoisochromanequinone
Product molecular weight(s):
acetyl-CoA_7: 342.38 Da
SCO5072
KR (Score: 159.4; E-value: 3.1e-49)
SCO5079
DIMER (Score: 426.8; E-value: 8.7e-131)
SCO5080
OXY (Score: 44.7; E-value: 2.1e-14)
SCO5086
KR C9 (Score: 438.4; E-value: 1.9e-134)
SCO5087
KS (Score: 768.6; E-value: 3.5e-234)
SCO5088
CLF 7 (Score: 743.5; E-value: 1.2e-226)
SCO5089
ACP (Score: 114.2; E-value: 5e-36)
SCO5090
CYC C7-C12 (Score: 404.0; E-value: 7.8e-124)
SCO5091
CYC C5-C14 (Score: 467.3; E-value: 4.4e-143)
SCO5094
MET (Score: 32.7; E-value: 9.8e-11)
SCO5097
KR (Score: 129.8; E-value: 3.3e-40)
NC_003888 - Region 12 - terpene
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 5,671,275 - 5,691,836 nt. (total: 20,562 nt) Show pHMM detection rules used
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 13 - T2PKS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 5,751,945 - 5,824,487 nt. (total: 72,543 nt) Show pHMM detection rules used
T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Type II PKS
Type II PKS gene cluster prediction details
Predictions of starter units, elongations, product classes, and potential molecular weights for type II PKS clusters.
More detailed information is available here.
Cluster section:
5751944 to 5824487
Starter unit(s):
acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):
pentangular polyphenol
tetracenomycin
SCO5314
CYC C4-C21/C2-C23|C2-C19 (Score: 154.8; E-value: 1.5e-48)
SCO5315
CYC C9-C14 (Score: 250.4; E-value: 1.1e-77)
SCO5316
ACP (Score: 73.9; E-value: 1.8e-23)
SCO5317
CLF (Score: 555.8; E-value: 1.2e-169)
SCO5318
KS (Score: 712.5; E-value: 3.7e-217)
SCO5319
CYC C5-C18 (Score: 218.4; E-value: 5.6e-68)
SCO5321
OXY (Score: 243.9; E-value: 8.1e-75)
NC_003888 - Region 14 - siderophore
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 6,336,091 - 6,346,368 nt. (total: 10,278 nt) Show pHMM detection rules used
siderophore: IucA_IucC

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.

No matches found.

Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 15 - NRPS-like,T1PKS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 6,430,010 - 6,475,291 nt. (total: 45,282 nt) Show pHMM detection rules used
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 15, location 6430009 - 6475291:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(ala) + (pk - mal)

Direct lookup in NORINE database: strict or relaxed
NRPS/PKS monomer predictions
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
SCO5891: ala
Search NORINE for peptide: strict or relaxed

AMP-binding (16..427): ala
NRPSPredictor2: ala
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
gly, ala, val, leu, ile, abu, iva
Small clusters prediction:
gly, ala
Single AA prediction:
ala
Stachelhaus prediction details:
Stachelhaus sequence:
DLfYLAlV-K
Nearest Stachelhaus code:
iva
Stachelhaus code match:
70% (weak)


SCO5892: pk - mal
CAL_domain (60..508): pk
minowa: NH2
Prediction, score:
NH2: 118.5
fatty_acid: 37.5
AHBA: 6.5
shikimic_acid: 0.0
Acetyl-CoA: -1.6

PKS_AT (1316..1620): mal
minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 151.7
inactive: 95.9
Methoxymalonyl-CoA: 74.7
Methylmalonyl-CoA: 70.4
Ethylmalonyl-CoA: 43.0
Propionyl-CoA: 35.7
Isobutyryl-CoA: 31.9
CHC-CoA: 27.7
2-Methylbutyryl-CoA: 26.1
Benzoyl-CoA: 25.0
Acetyl-CoA: 13.9
trans-1,2-CPDA: 13.7
3-Methylbutyryl-CoA: 12.5
fatty_acid: 9.7

ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 95.8%
inactive: 83.3%
2-Rhyd-Malonyl-CoA: 54.2%


NC_003888 - Region 16 - bacteriocin
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 6,632,343 - 6,643,659 nt. (total: 11,317 nt) Show pHMM detection rules used
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.

No matches found.

Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 17 - terpene
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 6,656,904 - 6,676,224 nt. (total: 19,321 nt) Show pHMM detection rules used
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 18 - siderophore
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 6,842,315 - 6,855,522 nt. (total: 13,208 nt) Show pHMM detection rules used
siderophore: IucA_IucC

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 19 - T1PKS,butyrolactone
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 6,881,335 - 6,951,537 nt. (total: 70,203 nt) Show pHMM detection rules used
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
butyrolactone: AfsA

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 19, location 6881334 - 6951537:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(mal - ccmal - ccmal) + (ccmal - ccmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed
NRPS/PKS monomer predictions
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
SCO6273: ccmal
PKS_AT (565..854): ccmal
minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 171.9
inactive: 73.8
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 40.8
Propionyl-CoA: 29.3
Acetyl-CoA: 18.6
Isobutyryl-CoA: 15.6
2-Methylbutyryl-CoA: 14.1
Benzoyl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 91.7%
inactive: 70.8%
Propionyl-CoA: 54.2%


SCO6274: ccmal - ccmal
PKS_AT (578..871): ccmal
minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 171.9
inactive: 73.8
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 40.8
Propionyl-CoA: 29.3
Acetyl-CoA: 18.6
Isobutyryl-CoA: 15.6
2-Methylbutyryl-CoA: 14.1
Benzoyl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 91.7%
inactive: 70.8%
Propionyl-CoA: 54.2%

PKS_AT (2332..2621): ccmal
minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 171.9
inactive: 73.8
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 40.8
Propionyl-CoA: 29.3
Acetyl-CoA: 18.6
Isobutyryl-CoA: 15.6
2-Methylbutyryl-CoA: 14.1
Benzoyl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 91.7%
inactive: 70.8%
Propionyl-CoA: 54.2%


SCO6275: mal - ccmal - ccmal
PKS_AT (548..829): mal
minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 209.2
inactive: 103.5
Methoxymalonyl-CoA: 75.4
Methylmalonyl-CoA: 68.4
Isobutyryl-CoA: 37.8
2-Methylbutyryl-CoA: 31.3
Benzoyl-CoA: 30.9
Acetyl-CoA: 30.9
Propionyl-CoA: 29.8
Ethylmalonyl-CoA: 28.1
fatty_acid: 20.5
CHC-CoA: 16.6
3-Methylbutyryl-CoA: 15.4
trans-1,2-CPDA: 15.0

ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 91.7%
inactive: 70.8%
Methylmalonyl-CoA: 58.3%

PKS_AT (1549..1846): ccmal
minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 203.5
inactive: 97.1
Methoxymalonyl-CoA: 72.9
Methylmalonyl-CoA: 61.7
Isobutyryl-CoA: 41.7
Propionyl-CoA: 30.9
Ethylmalonyl-CoA: 16.8
Acetyl-CoA: 16.8
2-Methylbutyryl-CoA: 14.2
Benzoyl-CoA: 13.3
3-Methylbutyryl-CoA: 9.0
fatty_acid: 8.4
CHC-CoA: 3.9
trans-1,2-CPDA: 0.0

ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 95.8%
inactive: 79.2%
Methylmalonyl-CoA: 58.3%

PKS_AT (3286..3585): ccmal
minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 207.6
inactive: 105.9
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 50.9
Propionyl-CoA: 30.8
Ethylmalonyl-CoA: 17.7
Isobutyryl-CoA: 16.7
2-Methylbutyryl-CoA: 15.7
Acetyl-CoA: 15.4
Benzoyl-CoA: 11.6
CHC-CoA: 9.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0

ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 100.0%
inactive: 87.5%
2-Rhyd-Malonyl-CoA: 54.2%


NC_003888 - Region 20 - NRPS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 7,088,518 - 7,135,153 nt. (total: 46,636 nt) Show pHMM detection rules used
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 21, location 7088517 - 7135153:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(X) + (cys)

Direct lookup in NORINE database: strict or relaxed
NRPS/PKS monomer predictions
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
SCO6431: X
Search NORINE for peptide: strict or relaxed

AMP-binding (9..399): X
NRPSPredictor2: (unknown)
SVM prediction details:
NOTE: outside applicability domain
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
gly, ala, val, leu, ile, abu, iva
Small clusters prediction:
val, leu, ile, abu, iva
Single AA prediction:
N/A
Stachelhaus prediction details:
Stachelhaus sequence:
tnrmFsVlYK
Nearest Stachelhaus code:
ile
Stachelhaus code match:
40% (weak)


SCO6432: cys
Search NORINE for peptide: strict or relaxed

AMP-binding (551..953): cys
NRPSPredictor2: cys
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
cys
Small clusters prediction:
cys
Single AA prediction:
cys
Stachelhaus prediction details:
Stachelhaus sequence:
DLFNLSLIWK
Nearest Stachelhaus code:
cys
Stachelhaus code match:
100% (strong)


NC_003888 - Region 21 - lanthipeptide
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 7,409,712 - 7,428,411 nt. (total: 18,700 nt) Show pHMM detection rules used
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
Lanthipeptides
ClusterBlast
KnownClusterBlast
SubClusterBlast
Lanthipeptide predictions
Lists the possible core peptides for each biosynthetic enzyme, including the predicted class. Each core peptide shows the leader and core peptide sequences, separated by a dash.

Lanthipeptide(s) for SCO6681 - Putative Class III


SCO6682 leader / core peptide
MNLFDLQSMETPKEEAMGDVE - DhbGDhaRADhaLLLCGDDhaDhaLDhaIDhbDhbCN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

Lanthipeptides
Core peptide predictions
Lists the possible core peptides in the region. Each core peptide lists the number of lanthionine bridges, possible molecular weights, and the scores for cleavage site prediction and RODEO.
SCO6682 - Class III
Cleavage pHMM score: 32.20
RODEO score: 0
Monoisotopic mass: 1954.0 Da
Molecular weight: 1955.2 Da
Number of bridges: 2
Alternative weights
(assuming N unmodified Ser/Thr residues)
1973.2 Da N = 1
1991.2 Da N = 2
2009.2 Da N = 3
2027.3 Da N = 4
2045.3 Da N = 5
2063.3 Da N = 6
NC_003888 - Region 22 - terpene
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 7,506,308 - 7,532,117 nt. (total: 25,810 nt) Show pHMM detection rules used
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
NC_003888 - Region 23 - PKS-like,T1PKS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 7,570,412 - 7,618,555 nt. (total: 48,144 nt) Show pHMM detection rules used
PKS-like: (t2pks2 or ksIII)
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 24, location 7570411 - 7618555:
Polymer prediction:
(redmmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 25, location 7570411 - 7611452:
Polymer prediction:
(redmmal)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 26, location 7571478 - 7618555:
Polymer prediction:
(redmmal)

Direct lookup in NORINE database: strict or relaxed
NRPS/PKS monomer predictions
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
SCO6827: redmmal
PKS_AT (548..845): redmmal
minowa: Methylmalonyl-CoA
Prediction, score:
Methylmalonyl-CoA: 165.7
Ethylmalonyl-CoA: 150.9
Methoxymalonyl-CoA: 141.2
2-Methylbutyryl-CoA: 118.3
Malonyl-CoA: 106.6
trans-1,2-CPDA: 94.3
Benzoyl-CoA: 90.8
Isobutyryl-CoA: 90.1
Propionyl-CoA: 89.7
CHC-CoA: 65.8
Acetyl-CoA: 62.2
inactive: 45.4
3-Methylbutyryl-CoA: 43.8
fatty_acid: 23.7

ATSignature: Methylmalonyl-CoA
Top 3 matches:
Methylmalonyl-CoA: 91.7%
Propionyl-CoA: 79.2%
Malonyl-CoA: 79.2%


NC_003888 - Region 24 - lanthipeptide
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 7,682,907 - 7,709,360 nt. (total: 26,454 nt) Show pHMM detection rules used
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
Lanthipeptides
ClusterBlast
KnownClusterBlast
SubClusterBlast
Lanthipeptide predictions
Lists the possible core peptides for each biosynthetic enzyme, including the predicted class. Each core peptide shows the leader and core peptide sequences, separated by a dash.

Lanthipeptide(s) for SCO6930 - Putative Class I


SCO6931 leader / core peptide
MNANTIKGQAHSPAATAGGDAFDLDISVLESDDGSATL - INLDhbDDGCGDhaDhbCDhaDhaPCADhbNVA
SCO6932 leader / core peptide
MQNDEFDLDISVLESDDGSATL - INLDhbDDGCGDhaDhbCDhaDhaPCADhbNVA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.

No matches found.

Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

Lanthipeptides
Core peptide predictions
Lists the possible core peptides in the region. Each core peptide lists the number of lanthionine bridges, possible molecular weights, and the scores for cleavage site prediction and RODEO.
SCO6931 - Class I
Cleavage pHMM score: 1.60
RODEO score: 23
Monoisotopic mass: 1919.8 Da
Molecular weight: 1921.1 Da
Number of bridges: 3
Alternative weights
(assuming N unmodified Ser/Thr residues)
1939.1 Da N = 1
1957.1 Da N = 2
1975.1 Da N = 3
SCO6932 - Class I
Cleavage pHMM score: 1.60
RODEO score: 23
Monoisotopic mass: 1919.8 Da
Molecular weight: 1921.1 Da
Number of bridges: 3
Alternative weights
(assuming N unmodified Ser/Thr residues)
1939.1 Da N = 1
1957.1 Da N = 2
1975.1 Da N = 3
NC_003888 - Region 25 - other
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 7,973,470 - 8,014,357 nt. (total: 40,888 nt) Show pHMM detection rules used
other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.

No matches found.

Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 26 - indole
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 8,269,637 - 8,290,764 nt. (total: 21,128 nt) Show pHMM detection rules used
indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NC_003888 - Region 27 - NRPS,T3PKS,terpene
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key.
More detailed help is available here.
Location: 8,475,102 - 8,548,352 nt. (total: 73,251 nt) Show pHMM detection rules used
T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codons
reset zoomreset view
zoomzoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details.
A glossary is available here.
Selected features only
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.
Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship.
Click on reference genes to show details of similarities to genes within the current region.

No matches found.

NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 30, location 8475101 - 8548352:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(X) + (arg - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 31, location 8475101 - 8516340:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(X) + (arg - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 32, location 8484460 - 8538497:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(X) + (arg - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed
NRPS/PKS monomer predictions
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
SCO7681: X
Search NORINE for peptide: strict or relaxed

AMP-binding (31..456): X
NRPSPredictor2: (unknown)
SVM prediction details:
NOTE: outside applicability domain
Predicted physicochemical class:
hydrophobic-aromatic
Large clusters prediction:
dhb, sal
Small clusters prediction:
dhb, sal
Single AA prediction:
dhb
Stachelhaus prediction details:
Stachelhaus sequence:
AfPsQGViNK
Nearest Stachelhaus code:
dhb
Stachelhaus code match:
70% (weak)


SCO7682: arg - cys
Search NORINE for peptide: strict or relaxed

AMP-binding (575..966): arg
NRPSPredictor2: arg
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
orn, lys, arg
Small clusters prediction:
arg
Single AA prediction:
arg
Stachelhaus prediction details:
Stachelhaus sequence:
DlwQLGLVhK
Nearest Stachelhaus code:
gly
Stachelhaus code match:
70% (weak)

AMP-binding (1632..2028): cys
NRPSPredictor2: cys
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
cys
Small clusters prediction:
cys
Single AA prediction:
cys
Stachelhaus prediction details:
Stachelhaus sequence:
DLYNLSmIWK
Nearest Stachelhaus code:
cys
Stachelhaus code match:
90% (moderate)


SCO7683: cys
Search NORINE for peptide: strict or relaxed

AMP-binding (544..942): cys
NRPSPredictor2: cys
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
cys
Small clusters prediction:
cys
Single AA prediction:
cys
Stachelhaus prediction details:
Stachelhaus sequence:
DLYNLSLIWK
Nearest Stachelhaus code:
cys
Stachelhaus code match:
100% (strong)