Identified secondary metabolite regions

Region Type From To Most similar known cluster Similarity MIBiG BGC-ID
The following regions are from record NC_003888.3:
Region 1 Otherks-T1pks 86640 139467 Leinamycin hybrid 2% BGC0001101
Region 2 Terpene 166891 191654 Isorenieratene terpene 100% BGC0000664
Region 3 Lanthipeptide 246868 270397
Region 4 Nrps 494260 544087 Coelichelin NRPS 100% BGC0000325
Region 5 Bacteriocin 791701 799942 Informatipeptin RiPP 42% BGC0000518
Region 6 T3pks 1258218 1297040 Herboxidiene polyketide 8% BGC0001065
Region 7 Ectoine 1995500 2005898 Ectoine other 100% BGC0000853
Region 8 Melanin 2939306 2949875 Melanin other 100% BGC0000910
Region 9 Siderophore 3034632 3045603 Desferrioxamine B other 83% BGC0000940
Region 10 Nrps 3524828 3603907 Calcium-dependent antibiotic NRPS 87% BGC0000315
Region 11 T2pks 5496474 5567376 Actinorhodin polyketide 100% BGC0000194
Region 12 Terpene 5671275 5691836 Albaflavenone terpene 100% BGC0000660
Region 13 T2pks 5751945 5824487 Spore pigment polyketide 66% BGC0000271
Region 14 Siderophore 6336091 6346368
Region 15 Nrpsfragment-T1pks 6430010 6475291 Undecylprodigiosin hybrid 100% BGC0001063
Region 16 Bacteriocin 6632343 6643659
Region 17 Terpene 6656904 6676224 Geosmin other 100% BGC0001181
Region 18 Siderophore 6842315 6855522 Enduracidin NRPS 6% BGC0000341
Region 19 Butyrolactone-T1pks 6881335 6951537 Coelimycin polyketide 100% BGC0000038
Region 20 Nrps 7088518 7135153 Nogalamycin polyketide 40% BGC0000249
Region 21 Lanthipeptide 7409712 7428411 SAL-2242 RiPP 100% BGC0000546
Region 22 Terpene 7506308 7532117 Hopene terpene 100% BGC0000663
Region 23 Otherks-T1pks 7570412 7618555 Arsenopolyketides polyketide 100% BGC0001283
Region 24 Lanthipeptide 7682907 7709360
Region 25 Other 7973470 8014357
Region 26 Indole 8269637 8290764 Ravidomycin polyketide 5% BGC0000263
Region 27 Nrps-T3pks-Terpene 8475102 8548352 Coelibactin NRPS 100% BGC0000324

NC_003888 - Region 1 - Otherks-t1pks

Location: 86640 - 139467 nt. Show pHMM detection rules used
otherks: (t2pks2 or hglE or hglD or ksIII)
t1pks: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

Predicted core structure(s)

For supercluster 1, location 86639 - 139467:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(ccmal) + (mxmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS domain predictions

SCO0126: ccmal
PKS_AT (611..907): ccmal
ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 79.2%
inactive: 70.8%
2-Rhyd-Malonyl-CoA: 58.3%

minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 81.1
Methoxymalonyl-CoA: 30.9
Methylmalonyl-CoA: 25.6
inactive: 23.2
Propionyl-CoA: 13.8
2-Methylbutyryl-CoA: 12.2
fatty_acid: 7.9
Isobutyryl-CoA: 1.8
CHC-CoA: 1.1
trans-1,2-CPDA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Ethylmalonyl-CoA: -3.2


SCO0127: mxmal
PKS_AT (968..1194): mxmal
ATSignature: (unknown)
No matches above 50%

minowa: Methoxymalonyl-CoA
Prediction, score:
Methoxymalonyl-CoA: 29.2
Methylmalonyl-CoA: 26.5
Malonyl-CoA: 22.1
Ethylmalonyl-CoA: 13.7
trans-1,2-CPDA: 0.0
inactive: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
Propionyl-CoA: -0.2
2-Methylbutyryl-CoA: -4.3


NC_003888 - Region 2 - Terpene

Location: 166891 - 191654 nt. Show pHMM detection rules used
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 3 - Lanthipeptide

Location: 246868 - 270397 nt. Show pHMM detection rules used
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not YcaO)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Lanthipeptide(s) for SCO0269 - Putative Class I


SCO0268 leader / core peptide
MRTEIVLSHEAPELDLDLDLRVSDLPEQA - ADhaFGEGDhbFDhbDhaPDhaDhaYAIGDhbRCPICC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar gene clusters

Similar known gene clusters

No matches found.

Similar subclusters

No matches found.

Prediction details

SCO0268 - Class I
Cleavage pHMM score: -8.70
RODEO score: 18
Monoisotopic mass: 2328.1 Da
Molecular weight: 2329.6 Da
Number of bridges: 3
Alternative weights
(assuming N unmodified Ser/Thr residues)
2347.6 Da N = 1
2365.6 Da N = 2
2383.7 Da N = 3
2401.7 Da N = 4

Database cross-links

NC_003888 - Region 4 - Nrps

Location: 494260 - 544087 nt. Show pHMM detection rules used
nrps: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

Predicted core structure(s)

For supercluster 4, location 494259 - 544087:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(orn - thr - orn)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS domain predictions

SCO0492: orn - thr - orn
Search NORINE for peptide: strict or relaxed

AMP-binding (142..540): orn
NRPSPredictor2: orn
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
orn, lys, arg
Small clusters prediction:
orn, horn
Single AA prediction:
orn
Nearest Stachelhaus code:
orn
Stachelhaus code match:
100%

AMP-binding (1625..2039): thr
NRPSPredictor2: thr
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
ser, thr, dhpg, hpg
Small clusters prediction:
thr
Single AA prediction:
thr
Nearest Stachelhaus code:
thr
Stachelhaus code match:
100%

AMP-binding (3060..3462): orn
NRPSPredictor2: orn
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
orn, lys, arg
Small clusters prediction:
N/A
Single AA prediction:
N/A
Nearest Stachelhaus code:
orn
Stachelhaus code match:
90%


NC_003888 - Region 5 - Bacteriocin

Location: 791701 - 799942 nt. Show pHMM detection rules used
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03605 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03882 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 6 - T3pks

Location: 1258218 - 1297040 nt. Show pHMM detection rules used
t3pks: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 7 - Ectoine

Location: 1995500 - 2005898 nt. Show pHMM detection rules used
ectoine: ectoine_synt

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 8 - Melanin

Location: 2939306 - 2949875 nt. Show pHMM detection rules used
melanin: melC

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 9 - Siderophore

Location: 3034632 - 3045603 nt. Show pHMM detection rules used
siderophore: IucA_IucC

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 10 - Nrps

Location: 3524828 - 3603907 nt. Show pHMM detection rules used
nrps: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

Predicted core structure(s)

For supercluster 10, location 3524827 - 3603907:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(ser - thr - trp - asp - asp - hpg) + (asp - gly - asn) + (3-me-glu - trp)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS domain predictions

SCO3230: ser - thr - trp - asp - asp - hpg
Search NORINE for peptide: strict or relaxed

AMP-binding (475..883): ser
NRPSPredictor2: ser
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
ser, thr, dhpg, hpg
Small clusters prediction:
ser
Single AA prediction:
ser
Nearest Stachelhaus code:
ser
Stachelhaus code match:
100%

AMP-binding (1674..2097): thr
NRPSPredictor2: thr
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
ser, thr, dhpg, hpg
Small clusters prediction:
thr
Single AA prediction:
thr
Nearest Stachelhaus code:
thr
Stachelhaus code match:
100%

AMP-binding (2759..3160): trp
NRPSPredictor2: trp
SVM prediction details:
Predicted physicochemical class:
N/A
Large clusters prediction:
phe, trp, phg, tyr, bht
Small clusters prediction:
phe, trp
Single AA prediction:
trp
Nearest Stachelhaus code:
trp
Stachelhaus code match:
100%

AMP-binding (4283..4657): asp
NRPSPredictor2: asp
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
asp, asn, glu, gln, aad
Small clusters prediction:
asp, asn
Single AA prediction:
asp
Nearest Stachelhaus code:
asp
Stachelhaus code match:
100%

AMP-binding (5323..5697): asp
NRPSPredictor2: asp
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
asp, asn, glu, gln, aad
Small clusters prediction:
asp, asn
Single AA prediction:
asp
Nearest Stachelhaus code:
asp
Stachelhaus code match:
100%

AMP-binding (6360..6777): hpg
NRPSPredictor2: hpg
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
ser, thr, dhpg, hpg
Small clusters prediction:
dhpg, hpg
Single AA prediction:
hpg
Nearest Stachelhaus code:
hpg
Stachelhaus code match:
100%


SCO3231: asp - gly - asn
Search NORINE for peptide: strict or relaxed

AMP-binding (472..845): asp
NRPSPredictor2: asp
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
asp, asn, glu, gln, aad
Small clusters prediction:
asp, asn
Single AA prediction:
asp
Nearest Stachelhaus code:
asp
Stachelhaus code match:
100%

AMP-binding (1504..1884): gly
NRPSPredictor2: gly
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
gly, ala, val, leu, ile, abu, iva
Small clusters prediction:
gly, ala
Single AA prediction:
gly
Nearest Stachelhaus code:
gly
Stachelhaus code match:
100%

AMP-binding (2567..2973): asn
NRPSPredictor2: asn
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
asp, asn, glu, gln, aad
Small clusters prediction:
asp, asn
Single AA prediction:
asn
Nearest Stachelhaus code:
asn
Stachelhaus code match:
100%


SCO3232: 3-me-glu - trp
Search NORINE for peptide: strict or relaxed

AMP-binding (467..874): 3-me-glu
NRPSPredictor2: 3-me-glu
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
gly, ala, val, leu, ile, abu, iva
Small clusters prediction:
asp, asn
Single AA prediction:
N/A
Nearest Stachelhaus code:
3-me-glu
Stachelhaus code match:
100%

AMP-binding (1541..1936): trp
NRPSPredictor2: trp
SVM prediction details:
Predicted physicochemical class:
N/A
Large clusters prediction:
phe, trp, phg, tyr, bht
Small clusters prediction:
phe, trp
Single AA prediction:
trp
Nearest Stachelhaus code:
trp
Stachelhaus code match:
100%


NC_003888 - Region 11 - T2pks

Location: 5496474 - 5567376 nt. Show pHMM detection rules used
t2pks: (t2ks and t2clf)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

NRPS/PKS domain predictions

Type II PKS gene cluster prediction details

Cluster section:
5496473 to 5567376
Starter unit(s):
acetyl-CoA (Score: 0.0; E-value: 0)
Malonyl elongations:
7 (Score: 743.5; E-value: 1.2e-226)
Product class(es):
benzoisochromanequinone
Product molecular weight(s):
acetyl-CoA_7: 342.38 Da
SCO5072
KR (Score: 159.4; E-value: 3.1e-49)
SCO5079
DIMER (Score: 426.8; E-value: 8.7e-131)
SCO5080
OXY (Score: 44.7; E-value: 2.1e-14)
SCO5086
KR C9 (Score: 438.4; E-value: 1.9e-134)
SCO5087
KS (Score: 768.6; E-value: 3.5e-234)
SCO5088
CLF 7 (Score: 743.5; E-value: 1.2e-226)
SCO5089
ACP (Score: 114.2; E-value: 5e-36)
SCO5090
CYC C7-C12 (Score: 404.0; E-value: 7.8e-124)
SCO5091
CYC C5-C14 (Score: 467.3; E-value: 4.4e-143)
SCO5094
MET (Score: 32.7; E-value: 9.8e-11)
SCO5097
KR (Score: 129.8; E-value: 3.3e-40)

NC_003888 - Region 12 - Terpene

Location: 5671275 - 5691836 nt. Show pHMM detection rules used
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 13 - T2pks

Location: 5751945 - 5824487 nt. Show pHMM detection rules used
t2pks: (t2ks and t2clf)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

NRPS/PKS domain predictions

Type II PKS gene cluster prediction details

Cluster section:
5751944 to 5824487
Starter unit(s):
acetyl-CoA (Score: 0.0; E-value: 0)
Product class(es):
pentangular polyphenol
tetracenomycin
SCO5314
CYC C4-C21/C2-C23|C2-C19 (Score: 154.8; E-value: 1.5e-48)
SCO5315
CYC C9-C14 (Score: 250.4; E-value: 1.1e-77)
SCO5316
ACP (Score: 73.9; E-value: 1.8e-23)
SCO5317
CLF (Score: 555.8; E-value: 1.2e-169)
SCO5318
KS (Score: 712.5; E-value: 3.7e-217)
SCO5319
CYC C5-C18 (Score: 218.4; E-value: 5.6e-68)
SCO5321
OXY (Score: 243.9; E-value: 8.1e-75)

NC_003888 - Region 14 - Siderophore

Location: 6336091 - 6346368 nt. Show pHMM detection rules used
siderophore: IucA_IucC

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

No matches found.

Similar subclusters

No matches found.

NC_003888 - Region 15 - Nrpsfragment-t1pks

Location: 6430010 - 6475291 nt. Show pHMM detection rules used
nrpsfragment: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))
t1pks: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

Predicted core structure(s)

For supercluster 15, location 6430009 - 6475291:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(ala) + (pk - mal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS domain predictions

SCO5891: ala
Search NORINE for peptide: strict or relaxed

AMP-binding (16..427): ala
NRPSPredictor2: ala
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
gly, ala, val, leu, ile, abu, iva
Small clusters prediction:
gly, ala
Single AA prediction:
ala
Nearest Stachelhaus code:
iva
Stachelhaus code match:
70%


SCO5892: pk - mal
CAL_domain (60..508): pk
minowa: NH2
Prediction, score:
NH2: 118.5
fatty_acid: 37.5
AHBA: 6.5
shikimic_acid: 0.0
Acetyl-CoA: -1.6

PKS_AT (1316..1620): mal
ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 95.8%
inactive: 83.3%
2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 151.7
inactive: 95.9
Methoxymalonyl-CoA: 74.7
Methylmalonyl-CoA: 70.4
Ethylmalonyl-CoA: 43.0
Propionyl-CoA: 35.7
Isobutyryl-CoA: 31.9
CHC-CoA: 27.7
2-Methylbutyryl-CoA: 26.1
Benzoyl-CoA: 25.0
Acetyl-CoA: 13.9
trans-1,2-CPDA: 13.7
3-Methylbutyryl-CoA: 12.5
fatty_acid: 9.7


NC_003888 - Region 16 - Bacteriocin

Location: 6632343 - 6643659 nt. Show pHMM detection rules used
bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03605 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03882 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

No matches found.

Similar subclusters

No matches found.

NC_003888 - Region 17 - Terpene

Location: 6656904 - 6676224 nt. Show pHMM detection rules used
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 18 - Siderophore

Location: 6842315 - 6855522 nt. Show pHMM detection rules used
siderophore: IucA_IucC

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 19 - Butyrolactone-t1pks

Location: 6881335 - 6951537 nt. Show pHMM detection rules used
butyrolactone: AfsA
t1pks: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

Predicted core structure(s)

For supercluster 19, location 6881334 - 6951537:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(mal - ccmal - ccmal) + (ccmal - ccmal) + (ccmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS domain predictions

SCO6273: ccmal
PKS_AT (565..854): ccmal
ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 91.7%
inactive: 70.8%
Propionyl-CoA: 54.2%

minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 171.9
inactive: 73.8
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 40.8
Propionyl-CoA: 29.3
Acetyl-CoA: 18.6
Isobutyryl-CoA: 15.6
2-Methylbutyryl-CoA: 14.1
Benzoyl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0


SCO6274: ccmal - ccmal
PKS_AT (578..871): ccmal
ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 91.7%
inactive: 70.8%
Propionyl-CoA: 54.2%

minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 171.9
inactive: 73.8
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 40.8
Propionyl-CoA: 29.3
Acetyl-CoA: 18.6
Isobutyryl-CoA: 15.6
2-Methylbutyryl-CoA: 14.1
Benzoyl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

PKS_AT (2332..2621): ccmal
ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 91.7%
inactive: 70.8%
Propionyl-CoA: 54.2%

minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 171.9
inactive: 73.8
Methoxymalonyl-CoA: 62.1
Methylmalonyl-CoA: 40.8
Propionyl-CoA: 29.3
Acetyl-CoA: 18.6
Isobutyryl-CoA: 15.6
2-Methylbutyryl-CoA: 14.1
Benzoyl-CoA: 9.6
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
3-Methylbutyryl-CoA: 0.0


SCO6275: mal - ccmal - ccmal
PKS_AT (548..829): mal
ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 91.7%
inactive: 70.8%
Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 209.2
inactive: 103.5
Methoxymalonyl-CoA: 75.4
Methylmalonyl-CoA: 68.4
Isobutyryl-CoA: 37.8
2-Methylbutyryl-CoA: 31.3
Benzoyl-CoA: 30.9
Acetyl-CoA: 30.9
Propionyl-CoA: 29.8
Ethylmalonyl-CoA: 28.1
fatty_acid: 20.5
CHC-CoA: 16.6
3-Methylbutyryl-CoA: 15.4
trans-1,2-CPDA: 15.0

PKS_AT (1549..1846): ccmal
ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 95.8%
inactive: 79.2%
Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 203.5
inactive: 97.1
Methoxymalonyl-CoA: 72.9
Methylmalonyl-CoA: 61.7
Isobutyryl-CoA: 41.7
Propionyl-CoA: 30.9
Ethylmalonyl-CoA: 16.8
Acetyl-CoA: 16.8
2-Methylbutyryl-CoA: 14.2
Benzoyl-CoA: 13.3
3-Methylbutyryl-CoA: 9.0
fatty_acid: 8.4
CHC-CoA: 3.9
trans-1,2-CPDA: 0.0

PKS_AT (3286..3585): ccmal
ATSignature: Malonyl-CoA
Top 3 matches:
Malonyl-CoA: 100.0%
inactive: 87.5%
2-Rhyd-Malonyl-CoA: 54.2%

minowa: Malonyl-CoA
Prediction, score:
Malonyl-CoA: 207.6
inactive: 105.9
Methoxymalonyl-CoA: 62.0
Methylmalonyl-CoA: 50.9
Propionyl-CoA: 30.8
Ethylmalonyl-CoA: 17.7
Isobutyryl-CoA: 16.7
2-Methylbutyryl-CoA: 15.7
Acetyl-CoA: 15.4
Benzoyl-CoA: 11.6
CHC-CoA: 9.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
3-Methylbutyryl-CoA: 0.0


NC_003888 - Region 20 - Nrps

Location: 7088518 - 7135153 nt. Show pHMM detection rules used
nrps: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

Predicted core structure(s)

For supercluster 21, location 7088517 - 7135153:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(nrp) + (cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS domain predictions

SCO6431: nrp
Search NORINE for peptide: strict or relaxed

AMP-binding (9..399): nrp
NRPSPredictor2: (unknown)
SVM prediction details:
NOTE: outside applicability domain
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
gly, ala, val, leu, ile, abu, iva
Small clusters prediction:
val, leu, ile, abu, iva
Single AA prediction:
N/A
Nearest Stachelhaus code:
ile
Stachelhaus code match:
40%


SCO6432: cys
Search NORINE for peptide: strict or relaxed

AMP-binding (551..953): cys
NRPSPredictor2: cys
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
cys
Small clusters prediction:
cys
Single AA prediction:
cys
Nearest Stachelhaus code:
cys
Stachelhaus code match:
100%


NC_003888 - Region 21 - Lanthipeptide

Location: 7409712 - 7428411 nt. Show pHMM detection rules used
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not YcaO)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Lanthipeptide(s) for SCO6681 - Putative Class III


SCO6682 leader / core peptide
MNLFDLQSMETPKEEAMGDVE - DhbGDhaRADhaLLLCGDDhaDhaLDhaIDhbDhbCN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

Prediction details

SCO6682 - Class III
Cleavage pHMM score: 32.20
RODEO score: 0
Monoisotopic mass: 1954.0 Da
Molecular weight: 1955.2 Da
Number of bridges: 2
Alternative weights
(assuming N unmodified Ser/Thr residues)
1973.2 Da N = 1
1991.2 Da N = 2
2009.2 Da N = 3
2027.3 Da N = 4
2045.3 Da N = 5
2063.3 Da N = 6

Database cross-links

NC_003888 - Region 22 - Terpene

Location: 7506308 - 7532117 nt. Show pHMM detection rules used
terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

NC_003888 - Region 23 - Otherks-t1pks

Location: 7570412 - 7618555 nt. Show pHMM detection rules used
otherks: (t2pks2 or hglE or hglD or ksIII)
t1pks: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

Predicted core structure(s)

For supercluster 24, location 7570411 - 7618555:
Polymer prediction:
(redmmal)

Direct lookup in NORINE database: strict or relaxed

For supercluster 26, location 7571478 - 7618555:
Polymer prediction:
(redmmal)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS domain predictions

SCO6827: redmmal
PKS_AT (548..845): redmmal
ATSignature: Methylmalonyl-CoA
Top 3 matches:
Methylmalonyl-CoA: 91.7%
Propionyl-CoA: 79.2%
Malonyl-CoA: 79.2%

minowa: Methylmalonyl-CoA
Prediction, score:
Methylmalonyl-CoA: 165.7
Ethylmalonyl-CoA: 150.9
Methoxymalonyl-CoA: 141.2
2-Methylbutyryl-CoA: 118.3
Malonyl-CoA: 106.6
trans-1,2-CPDA: 94.3
Benzoyl-CoA: 90.8
Isobutyryl-CoA: 90.1
Propionyl-CoA: 89.7
CHC-CoA: 65.8
Acetyl-CoA: 62.2
inactive: 45.4
3-Methylbutyryl-CoA: 43.8
fatty_acid: 23.7


NC_003888 - Region 24 - Lanthipeptide

Location: 7682907 - 7709360 nt. Show pHMM detection rules used
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not YcaO)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Lanthipeptide(s) for SCO6930 - Putative Class I


SCO6931 leader / core peptide
MNANTIKGQAHSPAATAGGDAFDLDISVLESDDGSATL - INLDhbDDGCGDhaDhbCDhaDhaPCADhbNVA
SCO6932 leader / core peptide
MQNDEFDLDISVLESDDGSATL - INLDhbDDGCGDhaDhbCDhaDhaPCADhbNVA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar gene clusters

Similar known gene clusters

No matches found.

Similar subclusters

No matches found.

Prediction details

SCO6931 - Class I
Cleavage pHMM score: 1.60
RODEO score: 23
Monoisotopic mass: 1919.8 Da
Molecular weight: 1921.1 Da
Number of bridges: 3
Alternative weights
(assuming N unmodified Ser/Thr residues)
1939.1 Da N = 1
1957.1 Da N = 2
1975.1 Da N = 3
SCO6932 - Class I
Cleavage pHMM score: 1.60
RODEO score: 23
Monoisotopic mass: 1919.8 Da
Molecular weight: 1921.1 Da
Number of bridges: 3
Alternative weights
(assuming N unmodified Ser/Thr residues)
1939.1 Da N = 1
1957.1 Da N = 2
1975.1 Da N = 3

Database cross-links

NC_003888 - Region 25 - Other

Location: 7973470 - 8014357 nt. Show pHMM detection rules used
other: (LmbU or Neocarzinostat or cycdipepsynth or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

No matches found.

Similar subclusters

No matches found.

NC_003888 - Region 26 - Indole

Location: 8269637 - 8290764 nt. Show pHMM detection rules used
indole: (indsynth or dmat or indole_PTase)

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NC_003888 - Region 27 - Nrps-t3pks-terpene

Location: 8475102 - 8548352 nt. Show pHMM detection rules used
nrps: (Chal_sti_synt_C or Chal_sti_synt_N)
t3pks: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)
terpene: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
resistance genes
other genes
TTA codon
reset zoomreset view
zoomzoom to selection

Gene details

Select a gene to view the details available for it

Detailed annotation

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

Predicted core structure(s)

For supercluster 30, location 8475101 - 8548352:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(nrp) + (arg - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed

For supercluster 31, location 8475101 - 8516340:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(nrp) + (arg - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed

For supercluster 32, location 8484460 - 8538497:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Polymer prediction:
(nrp) + (arg - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed

NRPS/PKS domain predictions

SCO7681: nrp
Search NORINE for peptide: strict or relaxed

AMP-binding (31..456): nrp
NRPSPredictor2: (unknown)
SVM prediction details:
NOTE: outside applicability domain
Predicted physicochemical class:
hydrophobic-aromatic
Large clusters prediction:
dhb, sal
Small clusters prediction:
dhb, sal
Single AA prediction:
dhb
Nearest Stachelhaus code:
dhb
Stachelhaus code match:
70%


SCO7682: arg - cys
Search NORINE for peptide: strict or relaxed

AMP-binding (575..966): arg
NRPSPredictor2: arg
SVM prediction details:
Predicted physicochemical class:
hydrophilic
Large clusters prediction:
orn, lys, arg
Small clusters prediction:
arg
Single AA prediction:
arg
Nearest Stachelhaus code:
gly
Stachelhaus code match:
70%

AMP-binding (1632..2028): cys
NRPSPredictor2: cys
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
cys
Small clusters prediction:
cys
Single AA prediction:
cys
Nearest Stachelhaus code:
cys
Stachelhaus code match:
90%


SCO7683: cys
Search NORINE for peptide: strict or relaxed

AMP-binding (544..942): cys
NRPSPredictor2: cys
SVM prediction details:
Predicted physicochemical class:
hydrophobic-aliphatic
Large clusters prediction:
cys
Small clusters prediction:
cys
Single AA prediction:
cys
Nearest Stachelhaus code:
cys
Stachelhaus code match:
100%